SCOPe 2.08: Domain d1wsxa1: 1wsx A:152-308

Lineage for d1wsxa1 (1wsx A:152-308)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (6 PDB entries)
   Uniprot P97287 152-308

8. Domain d1wsxa1: 1wsx A:152-308 [114867]
   Other proteins in same PDB: d1wsxa2

Details for d1wsxa1

PDB Entry: 1wsx

PDB Description: solution structure of mcl-1

PDB Compounds: (A:) myeloid cell leukemia sequence 1

SCOPe Domain Sequences for d1wsxa1:

Sequence; same for both SEQRES and ATOM records:

>d1wsxa1 f.1.4.1 (A:152-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
eddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqg
mlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqesfiepl
aetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

Timeline for d1wsxa1:

• d1wsxa1 first appeared in SCOP 1.71, called d1wsxa_
  
• d1wsxa1 appears in SCOPe 2.07