Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (9 proteins) Pfam 00452 |
Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [118213] (1 PDB entry) |
Domain d1wsxa_: 1wsx A: [114867] |
PDB Entry: 1wsx (more details)
SCOP Domain Sequences for d1wsxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wsxa_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus)} gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg
Timeline for d1wsxa_: