SCOP 1.71: Domain d1wsxa_: 1wsx A:

Lineage for d1wsxa_ (1wsx A:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (9 proteins)
   Pfam 00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (1 PDB entry)

8. Domain d1wsxa_: 1wsx A: [114867]

Details for d1wsxa_

PDB Entry: 1wsx

PDB Description: solution structure of mcl-1

SCOP Domain Sequences for d1wsxa_:

Sequence; same for both SEQRES and ATOM records:

>d1wsxa_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus)}
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

Timeline for d1wsxa_:

• d1wsxa_ is new in SCOP 1.71
  
• d1wsxa_ appears in SCOP 1.73
  
• d1wsxa_ appears in the current release, SCOPe 2.08, called d1wsxa1