| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core |
| Protein Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) [117155] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117156] (1 PDB entry) Uniprot Q5VUG0 181-285 |
| Domain d1wjra1: 1wjr A:8-121 [114709] Other proteins in same PDB: d1wjra2, d1wjra3 Structural genomics target; 2nd MBT repeat missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1wjr (more details)
SCOPe Domain Sequences for d1wjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjra1 b.34.9.3 (A:8-121) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]}
pidlitvgslielqdsqnpfqywivsvienvggrlrlryvgledtesydqwlfyldyrlr
pvgwcqenkyrmdppseiyplkmasewkctlekslidaakfplpmevfkdhadl
Timeline for d1wjra1: