Lineage for d1wjra1 (1wjr A:8-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784756Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 2784784Protein Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) [117155] (1 species)
  7. 2784785Species Human (Homo sapiens) [TaxId:9606] [117156] (1 PDB entry)
    Uniprot Q5VUG0 181-285
  8. 2784786Domain d1wjra1: 1wjr A:8-121 [114709]
    Other proteins in same PDB: d1wjra2, d1wjra3
    Structural genomics target; 2nd MBT repeat
    missing some secondary structures that made up less than one-third of the common domain

Details for d1wjra1

PDB Entry: 1wjr (more details)

PDB Description: solution structure of the 2nd mbt domain from human kiaa1617 protein
PDB Compounds: (A:) KIAA1617 protein

SCOPe Domain Sequences for d1wjra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjra1 b.34.9.3 (A:8-121) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]}
pidlitvgslielqdsqnpfqywivsvienvggrlrlryvgledtesydqwlfyldyrlr
pvgwcqenkyrmdppseiyplkmasewkctlekslidaakfplpmevfkdhadl

SCOPe Domain Coordinates for d1wjra1:

Click to download the PDB-style file with coordinates for d1wjra1.
(The format of our PDB-style files is described here.)

Timeline for d1wjra1: