![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) ![]() |
![]() | Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam 02820 contains extended 'arm', N-terminal to the common fold core |
![]() | Protein Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) [117155] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117156] (1 PDB entry) |
![]() | Domain d1wjra_: 1wjr A: [114709] Structural genomics target; 2nd MBT repeat |
PDB Entry: 1wjr (more details)
SCOP Domain Sequences for d1wjra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens)} gssgssgpidlitvgslielqdsqnpfqywivsvienvggrlrlryvgledtesydqwlf yldyrlrpvgwcqenkyrmdppseiyplkmasewkctlekslidaakfplpmevfkdhad lsgpssg
Timeline for d1wjra_: