Lineage for d1wjra_ (1wjr A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557875Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 557918Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam 02820
    contains extended 'arm', N-terminal to the common fold core
  6. 557946Protein Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) [117155] (1 species)
  7. 557947Species Human (Homo sapiens) [TaxId:9606] [117156] (1 PDB entry)
  8. 557948Domain d1wjra_: 1wjr A: [114709]
    Structural genomics target; 2nd MBT repeat

Details for d1wjra_

PDB Entry: 1wjr (more details)

PDB Description: solution structure of the 2nd mbt domain from human kiaa1617 protein

SCOP Domain Sequences for d1wjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens)}
gssgssgpidlitvgslielqdsqnpfqywivsvienvggrlrlryvgledtesydqwlf
yldyrlrpvgwcqenkyrmdppseiyplkmasewkctlekslidaakfplpmevfkdhad
lsgpssg

SCOP Domain Coordinates for d1wjra_:

Click to download the PDB-style file with coordinates for d1wjra_.
(The format of our PDB-style files is described here.)

Timeline for d1wjra_: