PDB entry 1wjr

View 1wjr on RCSB PDB site
Description: Solution structure of the 2nd mbt domain from human KIAA1617 protein
Class: protein binding
Keywords: mbt domain, KIAA1617 protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1617 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fj13890
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VUG0 (7-120)
      • cloning artifact (0-6)
      • cloning artifact (121-126)
    Domains in SCOPe 2.07: d1wjra1, d1wjra2, d1wjra3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjrA (A:)
    gssgssgpidlitvgslielqdsqnpfqywivsvienvggrlrlryvgledtesydqwlf
    yldyrlrpvgwcqenkyrmdppseiyplkmasewkctlekslidaakfplpmevfkdhad
    lsgpssg