| Class g: Small proteins [56992] (94 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Zinc finger protein 295, ZNF295 [118267] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [118268] (1 PDB entry) Uniprot Q9ULJ3 713-806 |
| Domain d1wjpa1: 1wjp A:8-42 [114705] Other proteins in same PDB: d1wjpa4, d1wjpa5 Structural genomics target complexed with zn |
PDB Entry: 1wjp (more details)
SCOPe Domain Sequences for d1wjpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjpa1 g.37.1.1 (A:8-42) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]}
aspvenkevyqcrlcnaklsslleqgsherlcrna
Timeline for d1wjpa1:
View in 3DDomains from same chain: (mouse over for more information) d1wjpa2, d1wjpa3, d1wjpa4, d1wjpa5 |