Lineage for d1wjpa1 (1wjp A:8-42)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035348Protein Zinc finger protein 295, ZNF295 [118267] (1 species)
  7. 3035349Species Human (Homo sapiens) [TaxId:9606] [118268] (1 PDB entry)
    Uniprot Q9ULJ3 713-806
  8. 3035350Domain d1wjpa1: 1wjp A:8-42 [114705]
    Other proteins in same PDB: d1wjpa4, d1wjpa5
    Structural genomics target
    complexed with zn

Details for d1wjpa1

PDB Entry: 1wjp (more details)

PDB Description: solution structure of zf-c2h2 domains from human zinc finger protein 295
PDB Compounds: (A:) Zinc finger protein 295

SCOPe Domain Sequences for d1wjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjpa1 g.37.1.1 (A:8-42) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]}
aspvenkevyqcrlcnaklsslleqgsherlcrna

SCOPe Domain Coordinates for d1wjpa1:

Click to download the PDB-style file with coordinates for d1wjpa1.
(The format of our PDB-style files is described here.)

Timeline for d1wjpa1: