Lineage for d1wjka_ (1wjk A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584502Family c.47.1.1: Thioltransferase [52834] (13 proteins)
  6. 584682Protein Thioredoxin-like structure containing protein C330018D20Rik [117593] (1 species)
  7. 584683Species Mouse (Mus musculus) [TaxId:10090] [117594] (1 PDB entry)
  8. 584684Domain d1wjka_: 1wjk A: [114700]
    Structural genomics target

Details for d1wjka_

PDB Entry: 1wjk (more details)

PDB Description: Solution structure of hypothetical protein C330018D20Rik from Mus musculus

SCOP Domain Sequences for d1wjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus)}
gssgssgnlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwy
erykfdipvfhlngqflmmhrvntsklekqlrklsgpssg

SCOP Domain Coordinates for d1wjka_:

Click to download the PDB-style file with coordinates for d1wjka_.
(The format of our PDB-style files is described here.)

Timeline for d1wjka_: