Lineage for d1wjka_ (1wjk A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 699188Protein Thioredoxin-like structure containing protein C330018D20Rik [117593] (1 species)
  7. 699189Species Mouse (Mus musculus) [TaxId:10090] [117594] (1 PDB entry)
  8. 699190Domain d1wjka_: 1wjk A: [114700]
    Structural genomics target

Details for d1wjka_

PDB Entry: 1wjk (more details)

PDB Description: Solution structure of hypothetical protein C330018D20Rik from Mus musculus
PDB Compounds: (A:) C330018D20rik protein

SCOP Domain Sequences for d1wjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgnlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwy
erykfdipvfhlngqflmmhrvntsklekqlrklsgpssg

SCOP Domain Coordinates for d1wjka_:

Click to download the PDB-style file with coordinates for d1wjka_.
(The format of our PDB-style files is described here.)

Timeline for d1wjka_: