Lineage for d1wjka1 (1wjk A:8-94)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876442Protein Thioredoxin-like structure containing protein C330018D20Rik [117593] (1 species)
  7. 2876443Species Mouse (Mus musculus) [TaxId:10090] [117594] (1 PDB entry)
    Uniprot Q9CWB7 21-107
  8. 2876444Domain d1wjka1: 1wjk A:8-94 [114700]
    Other proteins in same PDB: d1wjka2, d1wjka3
    Structural genomics target

Details for d1wjka1

PDB Entry: 1wjk (more details)

PDB Description: solution structure of hypothetical protein c330018d20rik from mus musculus
PDB Compounds: (A:) C330018D20rik protein

SCOPe Domain Sequences for d1wjka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjka1 c.47.1.1 (A:8-94) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}
nlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwyerykfdi
pvfhlngqflmmhrvntsklekqlrkl

SCOPe Domain Coordinates for d1wjka1:

Click to download the PDB-style file with coordinates for d1wjka1.
(The format of our PDB-style files is described here.)

Timeline for d1wjka1: