| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thioredoxin-like structure containing protein C330018D20Rik [117593] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [117594] (1 PDB entry) Uniprot Q9CWB7 21-107 |
| Domain d1wjka1: 1wjk A:8-94 [114700] Other proteins in same PDB: d1wjka2, d1wjka3 Structural genomics target |
PDB Entry: 1wjk (more details)
SCOPe Domain Sequences for d1wjka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjka1 c.47.1.1 (A:8-94) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}
nlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwyerykfdi
pvfhlngqflmmhrvntsklekqlrkl
Timeline for d1wjka1: