Lineage for d1wima_ (1wim A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1066942Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1066943Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1066944Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 1066988Protein UbcM4-interacting protein 4 (KIAA0161) [118296] (1 species)
  7. 1066989Species Human (Homo sapiens) [TaxId:9606] [118297] (1 PDB entry)
  8. 1066990Domain d1wima_: 1wim A: [114677]
    Structural genomics target; contains extra C-terminal IBR region
    complexed with zn

Details for d1wima_

PDB Entry: 1wim (more details)

PDB Description: solution structure of the ring finger domain of the human ubcm4- interacting protein 4
PDB Compounds: (A:) KIAA0161 protein

SCOPe Domain Sequences for d1wima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgcklclgeypveqmttiaqcqcifctlclkqyvellikegletaiscpdaacpk
qghlqeneiecmvaaeimqrykklqfersgpssg

SCOPe Domain Coordinates for d1wima_:

Click to download the PDB-style file with coordinates for d1wima_.
(The format of our PDB-style files is described here.)

Timeline for d1wima_: