Lineage for d1wima1 (1wim A:8-88)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037530Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 3037580Protein UbcM4-interacting protein 4 (KIAA0161) [118296] (1 species)
  7. 3037581Species Human (Homo sapiens) [TaxId:9606] [118297] (1 PDB entry)
  8. 3037582Domain d1wima1: 1wim A:8-88 [114677]
    Other proteins in same PDB: d1wima2, d1wima3
    Structural genomics target; contains extra C-terminal IBR region
    complexed with zn
    has additional insertions and/or extensions that are not grouped together

Details for d1wima1

PDB Entry: 1wim (more details)

PDB Description: solution structure of the ring finger domain of the human ubcm4- interacting protein 4
PDB Compounds: (A:) KIAA0161 protein

SCOPe Domain Sequences for d1wima1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wima1 g.44.1.1 (A:8-88) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}
cklclgeypveqmttiaqcqcifctlclkqyvellikegletaiscpdaacpkqghlqen
eiecmvaaeimqrykklqfer

SCOPe Domain Coordinates for d1wima1:

Click to download the PDB-style file with coordinates for d1wima1.
(The format of our PDB-style files is described here.)

Timeline for d1wima1: