| Class g: Small proteins [56992] (100 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
| Protein UbcM4-interacting protein 4 (KIAA0161) [118296] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [118297] (1 PDB entry) |
| Domain d1wima1: 1wim A:8-88 [114677] Other proteins in same PDB: d1wima2, d1wima3 Structural genomics target; contains extra C-terminal IBR region complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wim (more details)
SCOPe Domain Sequences for d1wima1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wima1 g.44.1.1 (A:8-88) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}
cklclgeypveqmttiaqcqcifctlclkqyvellikegletaiscpdaacpkqghlqen
eiecmvaaeimqrykklqfer
Timeline for d1wima1: