SCOP 1.71: Domain d1wi1a_: 1wi1 A:

Lineage for d1wi1a_ (1wi1 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
   Pfam 00169

6. Protein Calcium-dependent activator protein for secretion, CAPS [117252] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117253] (1 PDB entry)

8. Domain d1wi1a_: 1wi1 A: [114658]
   Structural genomics target

Details for d1wi1a_

PDB Entry: 1wi1

PDB Description: solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)

SCOP Domain Sequences for d1wi1a_:

Sequence; same for both SEQRES and ATOM records:

>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens)}
gssgssgmkhsgylwaigknvwkrwkkrffvlvqvsqytfamcsyrekkaepqellqldg
ytvdytdpqpgleggraffnavkegdtvifasddeqdrilwvqamyratgqshkpvpptq
sgpssg

Timeline for d1wi1a_:

• d1wi1a_ is new in SCOP 1.71
  
• d1wi1a_ appears in SCOP 1.73
  
• d1wi1a_ appears in the current release, SCOPe 2.08, called d1wi1a1