Lineage for d1wi1a1 (1wi1 A:8-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803115Protein Calcium-dependent activator protein for secretion, CAPS [117252] (1 species)
  7. 2803116Species Human (Homo sapiens) [TaxId:9606] [117253] (1 PDB entry)
    Uniprot Q8NFR0 522-634
  8. 2803117Domain d1wi1a1: 1wi1 A:8-120 [114658]
    Other proteins in same PDB: d1wi1a2, d1wi1a3
    Structural genomics target

Details for d1wi1a1

PDB Entry: 1wi1 (more details)

PDB Description: solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)
PDB Compounds: (A:) calcium-dependent activator protein for secretion, CAPS

SCOPe Domain Sequences for d1wi1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi1a1 b.55.1.1 (A:8-120) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]}
mkhsgylwaigknvwkrwkkrffvlvqvsqytfamcsyrekkaepqellqldgytvdytd
pqpgleggraffnavkegdtvifasddeqdrilwvqamyratgqshkpvpptq

SCOPe Domain Coordinates for d1wi1a1:

Click to download the PDB-style file with coordinates for d1wi1a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi1a1: