Lineage for d1whna1 (1whn A:350-464)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190525Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2190526Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2190595Protein tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) [117903] (1 species)
  7. 2190596Species Mouse (Mus musculus) [TaxId:10090] [117904] (1 PDB entry)
    Uniprot Q9D7B1 350-464
  8. 2190597Domain d1whna1: 1whn A:350-464 [114648]
    Other proteins in same PDB: d1whna2, d1whna3
    Structural genomics target

Details for d1whna1

PDB Entry: 1whn (more details)

PDB Description: solution structure of the dsrbd from hypothetical protein bab26260
PDB Compounds: (A:) hypothetical protein RIKEN cDNA 2310016K04

SCOPe Domain Sequences for d1whna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whna1 d.50.1.1 (A:350-464) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]}
sgiikmairfdrrayppqitpkmcllewcrreklpqpvyetvqrtidrmfcsvvtvaeqk
yqstlwdkskklaeqtaaivclrsqglpegrlgeespslnkrkreapdqdpggpr

SCOPe Domain Coordinates for d1whna1:

Click to download the PDB-style file with coordinates for d1whna1.
(The format of our PDB-style files is described here.)

Timeline for d1whna1: