Lineage for d1whna_ (1whn A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.50: dsRBD-like [54767] (4 superfamilies)
alpha-beta(3)-alpha; 2 layers: alpha/beta
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) 
Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (7 proteins)
Pfam 00035
Protein tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) [117903] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [117904] (1 PDB entry) 
Domain d1whna_: 1whn A: [114648]
Structural genomics target
Details for d1whna_
PDB Entry: 1whn (more details)
PDB Description: solution structure of the dsrbd from hypothetical protein bab26260
SCOP Domain Sequences for d1whna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus)}
gssgssgsgiikmairfdrrayppqitpkmcllewcrreklpqpvyetvqrtidrmfcsv
vtvaeqkyqstlwdkskklaeqtaaivclrsqglpegrlgeespslnkrkreapdqdpgg
prsgpssg
SCOP Domain Coordinates for d1whna_:
Click to download the PDB-style file with coordinates for d1whna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1whna_:
- d1whna_ is new in SCOP 1.71
- d1whna_ appears in SCOP 1.73
- d1whna_ appears in the current release, SCOPe 2.08, called d1whna1
View in 3D