Lineage for d1whha_ (1whh A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311302Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1311303Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1311313Protein CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) [117162] (2 species)
  7. 1311316Species Mouse (Mus musculus) [TaxId:10090] [117163] (1 PDB entry)
    Uniprot Q9DB67 19-107
  8. 1311317Domain d1whha_: 1whh A: [114643]
    Structural genomics target; fragment?

Details for d1whha_

PDB Entry: 1whh (more details)

PDB Description: solution structure of the 2nd cap-gly domain in mouse clip170-related 59kda protein clipr-59
PDB Compounds: (A:) clipr-59

SCOPe Domain Sequences for d1whha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkspsspslgslqqregakaevgdqvlvagqkqgivrfygktdfapgywygiel
dqptgkhdgsvfgvryftcaprhgvfapasriqrigsgpssg

SCOPe Domain Coordinates for d1whha_:

Click to download the PDB-style file with coordinates for d1whha_.
(The format of our PDB-style files is described here.)

Timeline for d1whha_: