Lineage for d1whha_ (1whh A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557953Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 557954Family b.34.10.1: Cap-Gly domain [74925] (5 proteins)
    Pfam 01302
  6. 557955Protein CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) [117162] (1 species)
  7. 557956Species Mouse (Mus musculus) [TaxId:10090] [117163] (1 PDB entry)
  8. 557957Domain d1whha_: 1whh A: [114643]
    Structural genomics target; fragment?

Details for d1whha_

PDB Entry: 1whh (more details)

PDB Description: Solution structure of the 2nd CAP-Gly domain in mouse CLIP170-related 59kDa protein CLIPR-59

SCOP Domain Sequences for d1whha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus)}
gssgssgkspsspslgslqqregakaevgdqvlvagqkqgivrfygktdfapgywygiel
dqptgkhdgsvfgvryftcaprhgvfapasriqrigsgpssg

SCOP Domain Coordinates for d1whha_:

Click to download the PDB-style file with coordinates for d1whha_.
(The format of our PDB-style files is described here.)

Timeline for d1whha_: