Lineage for d1whha1 (1whh A:8-96)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784910Protein CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) [117162] (2 species)
  7. 2784913Species Mouse (Mus musculus) [TaxId:10090] [117163] (1 PDB entry)
    Uniprot Q9DB67 19-107
  8. 2784914Domain d1whha1: 1whh A:8-96 [114643]
    Other proteins in same PDB: d1whha2, d1whha3
    Structural genomics target; fragment?

Details for d1whha1

PDB Entry: 1whh (more details)

PDB Description: solution structure of the 2nd cap-gly domain in mouse clip170-related 59kda protein clipr-59
PDB Compounds: (A:) clipr-59

SCOPe Domain Sequences for d1whha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whha1 b.34.10.1 (A:8-96) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]}
kspsspslgslqqregakaevgdqvlvagqkqgivrfygktdfapgywygieldqptgkh
dgsvfgvryftcaprhgvfapasriqrig

SCOPe Domain Coordinates for d1whha1:

Click to download the PDB-style file with coordinates for d1whha1.
(The format of our PDB-style files is described here.)

Timeline for d1whha1: