Lineage for d1whca_ (1whc A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763614Family a.5.2.1: UBA domain [46935] (24 proteins)
  6. 763697Protein UBA/UBX 33.3 kDa protein [116832] (1 species)
  7. 763698Species Mouse (Mus musculus) [TaxId:10090] [116833] (1 PDB entry)
    Uniprot Q922Y1 2-52
  8. 763699Domain d1whca_: 1whc A: [114640]
    Structural genomics target

Details for d1whca_

PDB Entry: 1whc (more details)

PDB Description: solution structure of rsgi ruh-027, a uba domain from mouse cdna
PDB Compounds: (A:) UBA/UBX 33.3 kDa protein

SCOP Domain Sequences for d1whca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgaeltalesliemgfprgraekalaltgnqgieaamdwlmeheddpdvdeplsg
pssg

SCOP Domain Coordinates for d1whca_:

Click to download the PDB-style file with coordinates for d1whca_.
(The format of our PDB-style files is described here.)

Timeline for d1whca_: