Lineage for d1whca1 (1whc A:8-58)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696098Protein UBA/UBX 33.3 kDa protein [116832] (1 species)
  7. 2696099Species Mouse (Mus musculus) [TaxId:10090] [116833] (1 PDB entry)
    Uniprot Q922Y1 2-52
  8. 2696100Domain d1whca1: 1whc A:8-58 [114640]
    Other proteins in same PDB: d1whca2, d1whca3
    Structural genomics target

Details for d1whca1

PDB Entry: 1whc (more details)

PDB Description: solution structure of rsgi ruh-027, a uba domain from mouse cdna
PDB Compounds: (A:) UBA/UBX 33.3 kDa protein

SCOPe Domain Sequences for d1whca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whca1 a.5.2.1 (A:8-58) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]}
aeltalesliemgfprgraekalaltgnqgieaamdwlmeheddpdvdepl

SCOPe Domain Coordinates for d1whca1:

Click to download the PDB-style file with coordinates for d1whca1.
(The format of our PDB-style files is described here.)

Timeline for d1whca1: