Lineage for d1whca_ (1whc A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534233Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 534257Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 534258Family a.5.2.1: UBA domain [46935] (11 proteins)
  6. 534283Protein UBA/UBX 33.3 kDa protein [116832] (1 species)
  7. 534284Species Mouse (Mus musculus) [TaxId:10090] [116833] (1 PDB entry)
  8. 534285Domain d1whca_: 1whc A: [114640]
    Structural genomics target

Details for d1whca_

PDB Entry: 1whc (more details)

PDB Description: Solution Structure of RSGI RUH-027, a UBA domain from Mouse cDNA

SCOP Domain Sequences for d1whca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus)}
gssgssgaeltalesliemgfprgraekalaltgnqgieaamdwlmeheddpdvdeplsg
pssg

SCOP Domain Coordinates for d1whca_:

Click to download the PDB-style file with coordinates for d1whca_.
(The format of our PDB-style files is described here.)

Timeline for d1whca_: