Lineage for d1wh2a1 (1wh2 A:8-72)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524880Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524881Superfamily d.76.1: GYF domain [55277] (1 family) (S)
  5. 2524882Family d.76.1.1: GYF domain [55278] (3 proteins)
    Pfam PF02213
  6. 2524890Protein Hypothetical rotein At5g08430 [118022] (1 species)
  7. 2524891Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118023] (1 PDB entry)
    Uniprot Q9FT92 444-508; structure of the N-terminal SWIB domain (25-112) is also known (101202)
  8. 2524892Domain d1wh2a1: 1wh2 A:8-72 [114630]
    Other proteins in same PDB: d1wh2a2, d1wh2a3
    Structural genomics target

Details for d1wh2a1

PDB Entry: 1wh2 (more details)

PDB Description: Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana
PDB Compounds: (A:) Hypothetical protein At5g08430

SCOPe Domain Sequences for d1wh2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh2a1 d.76.1.1 (A:8-72) Hypothetical rotein At5g08430 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vrvlsydkeklnwlykdpqglvqgpfsltqlkawsdaeyftkqfrvwmtgesmesavllt
dvlrl

SCOPe Domain Coordinates for d1wh2a1:

Click to download the PDB-style file with coordinates for d1wh2a1.
(The format of our PDB-style files is described here.)

Timeline for d1wh2a1: