PDB entry 1wh2

View 1wh2 on RCSB PDB site
Description: Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: GYF domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein At5g08430
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL09-47-K03
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FT92 (7-71)
      • cloning artifact (0-6)
      • cloning artifact (72-77)
    Domains in SCOPe 2.07: d1wh2a1, d1wh2a2, d1wh2a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh2A (A:)
    gssgssgvrvlsydkeklnwlykdpqglvqgpfsltqlkawsdaeyftkqfrvwmtgesm
    esavlltdvlrlsgpssg