Lineage for d1wh2a_ (1wh2 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605991Fold d.76: GYF domain [55276] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 605992Superfamily d.76.1: GYF domain [55277] (1 family) (S)
  5. 605993Family d.76.1.1: GYF domain [55278] (2 proteins)
    Pfam 02213
  6. 605998Protein Hypothetical rotein At5g08430 [118022] (1 species)
  7. 605999Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118023] (1 PDB entry)
  8. 606000Domain d1wh2a_: 1wh2 A: [114630]
    Structural genomics target

Details for d1wh2a_

PDB Entry: 1wh2 (more details)

PDB Description: solution structure of the gyf domain of a hypothetical protein from arabidopsis thaliana

SCOP Domain Sequences for d1wh2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh2a_ d.76.1.1 (A:) Hypothetical rotein At5g08430 {Thale cress (Arabidopsis thaliana)}
gssgssgvrvlsydkeklnwlykdpqglvqgpfsltqlkawsdaeyftkqfrvwmtgesm
esavlltdvlrlsgpssg

SCOP Domain Coordinates for d1wh2a_:

Click to download the PDB-style file with coordinates for d1wh2a_.
(The format of our PDB-style files is described here.)

Timeline for d1wh2a_: