Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 [117802] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117803] (1 PDB entry) Uniprot Q15011 10-90 |
Domain d1wgda_: 1wgd A: [114610] Structural genomics target |
PDB Entry: 1wgd (more details)
SCOPe Domain Sequences for d1wgda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} gssgssgvtllvkspnqrhrdlelsgdrgwsvghlkahlsrvyperprpedqrliysgkl lldhqclrdllpkqekrhvlhlvcnvksgpssg
Timeline for d1wgda_: