Lineage for d1wgda1 (1wgd A:8-88)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158346Protein Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 [117802] (1 species)
  7. 2158347Species Human (Homo sapiens) [TaxId:9606] [117803] (1 PDB entry)
    Uniprot Q15011 10-90
  8. 2158348Domain d1wgda1: 1wgd A:8-88 [114610]
    Other proteins in same PDB: d1wgda2, d1wgda3
    Structural genomics target

Details for d1wgda1

PDB Entry: 1wgd (more details)

PDB Description: Solution structure of the Ubl-domain of Herp
PDB Compounds: (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein

SCOPe Domain Sequences for d1wgda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgda1 d.15.1.1 (A:8-88) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]}
vtllvkspnqrhrdlelsgdrgwsvghlkahlsrvyperprpedqrliysgkllldhqcl
rdllpkqekrhvlhlvcnvks

SCOPe Domain Coordinates for d1wgda1:

Click to download the PDB-style file with coordinates for d1wgda1.
(The format of our PDB-style files is described here.)

Timeline for d1wgda1: