Lineage for d1wfya_ (1wfy A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598694Family d.15.1.5: Ras-binding domain, RBD [54263] (9 proteins)
    contains Pfam 00788 and Pfam 02196
  6. 598735Protein Regulator of G-protein signaling 14, RGS14 [117821] (1 species)
  7. 598736Species Mouse (Mus musculus) [TaxId:10090] [117822] (1 PDB entry)
  8. 598737Domain d1wfya_: 1wfy A: [114597]
    Structural genomics target

Details for d1wfya_

PDB Entry: 1wfy (more details)

PDB Description: solution structure of the ras-binding domain of mouse rgs14

SCOP Domain Sequences for d1wfya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfya_ d.15.1.5 (A:) Regulator of G-protein signaling 14, RGS14 {Mouse (Mus musculus)}
gssgssgdqevrlenritfqlelvglervvrisakptkrlqealqpilakhglsldqvvl
hrpgekqpmdlenpvssvasqtlvldtppdakmsearssgpssg

SCOP Domain Coordinates for d1wfya_:

Click to download the PDB-style file with coordinates for d1wfya_.
(The format of our PDB-style files is described here.)

Timeline for d1wfya_: