Lineage for d1wfya1 (1wfy A:8-98)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. Protein Regulator of G-protein signaling 14, RGS14 [117821] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [117822] (1 PDB entry)
    Uniprot P97492 366-456
  8. Domain d1wfya1: 1wfy A:8-98 [114597]
    Other proteins in same PDB: d1wfya2, d1wfya3
    Structural genomics target

Details for d1wfya1

PDB Entry: 1wfy (more details)

PDB Description: Solution structure of the Ras-binding domain of mouse RGS14
PDB Compounds: (A:) regulator of G-protein signaling 14; rap1/rap2 interacting protein

SCOPe Domain Sequences for d1wfya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfya1 d.15.1.5 (A:8-98) Regulator of G-protein signaling 14, RGS14 {Mouse (Mus musculus) [TaxId: 10090]}
dqevrlenritfqlelvglervvrisakptkrlqealqpilakhglsldqvvlhrpgekq
pmdlenpvssvasqtlvldtppdakmsears

SCOPe Domain Coordinates for d1wfya1 are not available.

Timeline for d1wfya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wfya2, d1wfya3