SCOP 1.73: Domain d1wfya_: 1wfy A:

Lineage for d1wfya_ (1wfy A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins)
   contains Pfam PF00788 and Pfam 02196

6. Protein Regulator of G-protein signaling 14, RGS14 [117821] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117822] (1 PDB entry)

8. Domain d1wfya_: 1wfy A: [114597]
   Structural genomics target

Details for d1wfya_

PDB Entry: 1wfy

PDB Description: solution structure of the ras-binding domain of mouse rgs14

PDB Compounds: (A:) regulator of G-protein signaling 14; rap1/rap2 interacting protein

SCOP Domain Sequences for d1wfya_:

Sequence; same for both SEQRES and ATOM records:

>d1wfya_ d.15.1.5 (A:) Regulator of G-protein signaling 14, RGS14 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgdqevrlenritfqlelvglervvrisakptkrlqealqpilakhglsldqvvl
hrpgekqpmdlenpvssvasqtlvldtppdakmsearssgpssg

Timeline for d1wfya_:

• d1wfya_ first appeared in SCOP 1.71
  
• d1wfya_ appears in SCOP 1.75
  
• d1wfya_ appears in the current release, SCOPe 2.08, called d1wfya1