SCOPe 2.07: Domain d1wfga1: 1wfg A:8-125

Lineage for d1wfga1 (1wfg A:8-125)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein DNA Regulating synaptic membrane exocytosis protein 2, RIMS2 [117176] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117177] (1 PDB entry)
   Uniprot Q9UQ26 637-754; the structure of the 1st C2 domain (807-934) is also known (101565)

8. Domain d1wfga1: 1wfg A:8-125 [114581]
   Other proteins in same PDB: d1wfga2, d1wfga3
   Structural genomics target

Details for d1wfga1

PDB Entry: 1wfg

PDB Description: pdz domain of human rim2b

PDB Compounds: (A:) Regulating synaptic membrane exocytosis protein 2

SCOPe Domain Sequences for d1wfga1:

Sequence; same for both SEQRES and ATOM records:

>d1wfga1 b.36.1.1 (A:8-125) DNA Regulating synaptic membrane exocytosis protein 2, RIMS2 {Human (Homo sapiens) [TaxId: 9606]}
hshsdkhpvtwqpskdgdrligrillnkrlkdgsvprdsgamlglkvvggkmtesgrlca
fitkvkkgsladtvghlrpgdevlewngrllqgatfeevyniileskpepqvelvvsr

Timeline for d1wfga1:

• d1wfga1 first appeared in SCOP 1.71, called d1wfga_
  
• d1wfga1 appears in SCOPe 2.06
  
• d1wfga1 appears in the current release, SCOPe 2.08