![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein DNA Regulating synaptic membrane exocytosis protein 2, RIMS2 [117176] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117177] (1 PDB entry) Uniprot Q9UQ26 637-754; the structure of the 1st C2 domain (807-934) is also known (101565) |
![]() | Domain d1wfga1: 1wfg A:8-125 [114581] Other proteins in same PDB: d1wfga2, d1wfga3 Structural genomics target |
PDB Entry: 1wfg (more details)
SCOPe Domain Sequences for d1wfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfga1 b.36.1.1 (A:8-125) DNA Regulating synaptic membrane exocytosis protein 2, RIMS2 {Human (Homo sapiens) [TaxId: 9606]} hshsdkhpvtwqpskdgdrligrillnkrlkdgsvprdsgamlglkvvggkmtesgrlca fitkvkkgsladtvghlrpgdevlewngrllqgatfeevyniileskpepqvelvvsr
Timeline for d1wfga1: