SCOPe 2.06: Domain d1wf7a1: 1wf7 A:8-97

Lineage for d1wf7a1 (1wf7 A:8-97)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Enigma homolog ENH [117174] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117175] (1 PDB entry)
   Uniprot Q8CI51 5-94

8. Domain d1wf7a1: 1wf7 A:8-97 [114577]
   Other proteins in same PDB: d1wf7a2, d1wf7a3
   Structural genomics target

Details for d1wf7a1

PDB Entry: 1wf7

PDB Description: solution structure of the pdz domain of enigma homologue protein

PDB Compounds: (A:) Enigma homologue protein

SCOPe Domain Sequences for d1wf7a1:

Sequence; same for both SEQRES and ATOM records:

>d1wf7a1 b.36.1.1 (A:8-97) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]}
svslvgpapwgfrlqggkdfnmpltisslkdggkasqahvrigdvvlsidgisaqgmthl
eaqnkikactgslnmtlqrasaaaksepvs

Timeline for d1wf7a1:

• d1wf7a1 first appeared in SCOP 1.71, called d1wf7a_
  
• d1wf7a1 was called d1wf7a_ in SCOPe 2.05
  
• d1wf7a1 appears in SCOPe 2.07
  
• d1wf7a1 appears in the current release, SCOPe 2.08