PDB entry 1wf7

View 1wf7 on RCSB PDB site
Description: Solution structure of the PDZ domain of Enigma homologue protein
Class: Structural genomics, unknown function
Keywords: PDZ domain, Enigma homologue protein, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Enigma homologue protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN 1110001A05
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CI51 (7-96)
    • cloning artifact (0-6)
    • cloning artifact (97-102)
  Domains in SCOPe 2.06: d1wf7a1, d1wf7a2, d1wf7a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wf7A (A:)
  gssgssgsvslvgpapwgfrlqggkdfnmpltisslkdggkasqahvrigdvvlsidgis
  aqgmthleaqnkikactgslnmtlqrasaaaksepvssgpssg