SCOPe 2.04: Domain d1weza_: 1wez A:

Lineage for d1weza_ (1wez A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Heterogeneous nuclear ribonucleoprotein H' [117955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117956] (2 PDB entries)
   Uniprot P55795 103-193; 280-369

8. Domain d1weza_: 1wez A: [114570]
   Structural genomics target; 2nd RBD

Details for d1weza_

PDB Entry: 1wez

PDB Description: solution structure of rrm domain in heterogeneous nuclear ribonucleoprotein h'

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein H'

SCOPe Domain Sequences for d1weza_:

Sequence; same for both SEQRES and ATOM records:

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}
gssgssgssfqsttghcvhmrglpyratendiynffsplnpmrvhieigpdgrvtgeadv
efathedavaamakdkanmqhryvelflnstagtsgsgpssg

Timeline for d1weza_:

• d1weza_ first appeared in SCOP 1.71
  
• d1weza_ appears in SCOPe 2.03
  
• d1weza_ appears in SCOPe 2.05
  
• d1weza_ appears in the current release, SCOPe 2.08, called d1weza1