Lineage for d1wehb_ (1weh B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530140Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2530141Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) (S)
  5. 2530142Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
    Pfam PF03641
  6. 2530169Protein Hypothetical protein TT1887 (TTHA0294) [117563] (1 species)
  7. 2530170Species Thermus thermophilus [TaxId:274] [117564] (1 PDB entry)
    Uniprot Q5SLJ9
  8. 2530172Domain d1wehb_: 1weh B: [114552]
    Structural genomics target

Details for d1wehb_

PDB Entry: 1weh (more details), 1.8 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1887 from Thermus thermophilus HB8
PDB Compounds: (B:) Conserved hypothetical protein TT1887

SCOPe Domain Sequences for d1wehb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wehb_ c.129.1.1 (B:) Hypothetical protein TT1887 (TTHA0294) {Thermus thermophilus [TaxId: 274]}
mrllavfvssrlspedplyarwvrygevlaeegfglacggyqggmealargvkakgglvv
gvtapaffperrgpnpfvdlelpaatlpqrigrlldlgagylalpggvgtlaelvlawnl
lylrrgvgrplavdpywlgllkahgeiapedvgllrvvadeedlrrflrsl

SCOPe Domain Coordinates for d1wehb_:

Click to download the PDB-style file with coordinates for d1wehb_.
(The format of our PDB-style files is described here.)

Timeline for d1wehb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1weha_