SCOP 1.71: Domain d1wehb_: 1weh B:

Lineage for d1wehb_ (1weh B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.129: Putative lysine decarboxylase [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: Putative lysine decarboxylase [102405] (1 family)

5. Family c.129.1.1: Putative lysine decarboxylase [102406] (5 proteins)
   Pfam 03641

6. Protein Hypothetical protein TT1887 (TTHA0294) [117563] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117564] (1 PDB entry)

8. Domain d1wehb_: 1weh B: [114552]
   Structural genomics target

Details for d1wehb_

PDB Entry: 1weh, 1.8 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1887 from Thermus thermophilus HB8

SCOP Domain Sequences for d1wehb_:

Sequence; same for both SEQRES and ATOM records:

>d1wehb_ c.129.1.1 (B:) Hypothetical protein TT1887 (TTHA0294) {Thermus thermophilus}
mrllavfvssrlspedplyarwvrygevlaeegfglacggyqggmealargvkakgglvv
gvtapaffperrgpnpfvdlelpaatlpqrigrlldlgagylalpggvgtlaelvlawnl
lylrrgvgrplavdpywlgllkahgeiapedvgllrvvadeedlrrflrsl

Timeline for d1wehb_:

• d1wehb_ is new in SCOP 1.71
  
• d1wehb_ appears in SCOP 1.73
  
• d1wehb_ appears in the current release, SCOPe 2.08