Lineage for d1wc3a_ (1wc3 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029721Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1029722Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 1029723Protein Adenylate cyclase CyaC [117982] (1 species)
  7. 1029724Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
    Uniprot O32393 1004-1200
  8. 1029725Domain d1wc3a_: 1wc3 A: [114495]
    complexed with apc, sr

Details for d1wc3a_

PDB Entry: 1wc3 (more details), 1.9 Å

PDB Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-atp and strontium
PDB Compounds: (A:) adenylate cyclase

SCOPe Domain Sequences for d1wc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wc3a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
shmrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgd
aimalygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgih
qgmavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikrefl
elkgidepvmtcvinpnml

SCOPe Domain Coordinates for d1wc3a_:

Click to download the PDB-style file with coordinates for d1wc3a_.
(The format of our PDB-style files is described here.)

Timeline for d1wc3a_: