SCOP 1.71: Domain d1wc3a_: 1wc3 A:

Lineage for d1wc3a_ (1wc3 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam 00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylate cyclase CyaC [117982] (1 species)

7. Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)

8. Domain d1wc3a_: 1wc3 A: [114495]

Details for d1wc3a_

PDB Entry: 1wc3, 1.9 Å

PDB Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-atp and strontium

SCOP Domain Sequences for d1wc3a_:

Sequence; same for both SEQRES and ATOM records:

>d1wc3a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis}
shmrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgd
aimalygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgih
qgmavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikrefl
elkgidepvmtcvinpnml

Timeline for d1wc3a_:

• d1wc3a_ is new in SCOP 1.71
  
• d1wc3a_ appears in SCOP 1.73
  
• d1wc3a_ appears in the current release, SCOPe 2.08, called d1wc3a1