Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins) |
Protein Hypothetical protein BH0236 [117106] (1 species) |
Species Bacillus halodurans [TaxId:86665] [117107] (3 PDB entries) Uniprot Q9KG76 790-923 |
Domain d1w9sb_: 1w9s B: [114417] complexed with gol, na |
PDB Entry: 1w9s (more details), 1.59 Å
SCOPe Domain Sequences for d1w9sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9sb_ b.18.1.10 (B:) Hypothetical protein BH0236 {Bacillus halodurans [TaxId: 86665]} dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp eydlmnvnwfvfra
Timeline for d1w9sb_: