Lineage for d1w9sb_ (1w9s B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 555066Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 555084Protein Hypothetical protein BH0236 [117106] (1 species)
  7. 555085Species Bacillus halodurans [TaxId:86665] [117107] (3 PDB entries)
  8. 555087Domain d1w9sb_: 1w9s B: [114417]
    complexed with gol, na

Details for d1w9sb_

PDB Entry: 1w9s (more details), 1.59 Å

PDB Description: structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans

SCOP Domain Sequences for d1w9sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9sb_ b.18.1.10 (B:) Hypothetical protein BH0236 {Bacillus halodurans}
dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
eydlmnvnwfvfra

SCOP Domain Coordinates for d1w9sb_:

Click to download the PDB-style file with coordinates for d1w9sb_.
(The format of our PDB-style files is described here.)

Timeline for d1w9sb_: