Lineage for d1w9aa_ (1w9a A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.45: Split barrel-like [50474] (3 superfamilies)
barrel; n=6, S=10; greek-keySuperfamily b.45.1: FMN-binding split barrel [50475] (5 families) 
related to the ferredoxin reductase-like FAD-binding domainFamily b.45.1.1: PNP-oxidase like [50476] (17 proteins) 
Protein Hypothetical protein Rv1155 [117230] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
Uniprot O06553
Domain d1w9aa_: 1w9a A: [114408]
Structural genomics target
Details for d1w9aa_
PDB Entry: 1w9a (more details), 1.8 Å
PDB Description: Crystal structure of Rv1155 from Mycobacterium tuberculosis
PDB Compounds: (A:) putative pyridoxine/pyridoxamine 5'-phosphate oxidaseSCOPe Domain Sequences for d1w9aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9aa_ b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
fddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdp
rasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamv
tdrrvlltlpishvyglppgmr
SCOPe Domain Coordinates for d1w9aa_:
Click to download the PDB-style file with coordinates for d1w9aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w9aa_:
- d1w9aa_ first appeared in SCOP 1.71
- d1w9aa_ appears in SCOPe 2.07
View in 3D
