SCOP 1.71: Domain d1w9aa_: 1w9a A:

Lineage for d1w9aa_ (1w9a A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (2 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (6 proteins)

6. Protein Hypothetical protein Rv1155 [117230] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117231] (2 PDB entries)

8. Domain d1w9aa_: 1w9a A: [114408]

Details for d1w9aa_

PDB Entry: 1w9a, 1.8 Å

PDB Description: Crystal structure of Rv1155 from Mycobacterium tuberculosis

SCOP Domain Sequences for d1w9aa_:

Sequence; same for both SEQRES and ATOM records:

>d1w9aa_ b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis}
fddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdp
rasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamv
tdrrvlltlpishvyglppgmr

Timeline for d1w9aa_:

• d1w9aa_ is new in SCOP 1.71
  
• d1w9aa_ appears in SCOP 1.73
  
• d1w9aa_ appears in the current release, SCOPe 2.08