PDB entry 1w9a

View 1w9a on RCSB PDB site
Description: Crystal structure of Rv1155 from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: structural genomics, oxidoreductase, related to fmn-binding proteins
Deposited on 2004-10-07, released 2005-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.143
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative pyridoxine/pyridoxamine 5'-phosphate oxidase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9aa_
  • Chain 'B':
    Compound: putative pyridoxine/pyridoxamine 5'-phosphate oxidase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9aA (A:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9aA (A:)
    fddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdp
    rasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamv
    tdrrvlltlpishvyglppgmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9aB (B:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9aB (B:)
    vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
    prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
    vtdrrvlltlpishvyglppgmr