Lineage for d1w93a1 (1w93 A:451-566)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072005Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2072108Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2072109Family b.84.2.1: BC C-terminal domain-like [51247] (5 protein domains)
    probable rudiment form of the biotinyl-carrier domain
  6. 2072110Protein Acetyl-CoA carboxylase, BC-C subdomain [117328] (1 species)
  7. 2072111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117329] (2 PDB entries)
    Uniprot Q00955 13-566
  8. 2072115Domain d1w93a1: 1w93 A:451-566 [114394]
    Other proteins in same PDB: d1w93a2, d1w93a3

Details for d1w93a1

PDB Entry: 1w93 (more details), 2.5 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae
PDB Compounds: (A:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1w93a1:

Sequence, based on SEQRES records: (download)

>d1w93a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvgnngnihsfsdsqfghif
afgenrqasrkhmvvalkelsirgdfrttveyliklletedfedntittgwlddli

Sequence, based on observed residues (ATOM records): (download)

>d1w93a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvgnngnihsfsdsqfghif
afgenrqasrkhmvvalkelsirgtveyliklletedfedntittgwlddli

SCOPe Domain Coordinates for d1w93a1:

Click to download the PDB-style file with coordinates for d1w93a1.
(The format of our PDB-style files is described here.)

Timeline for d1w93a1: