Lineage for d1w93a2 (1w93 A:14-183)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. Protein Acetyl-CoA carboxylase, BC-N subdomain [117496] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117497] (2 PDB entries)
    Uniprot Q00955 13-566
  8. Domain d1w93a2: 1w93 A:14-183 [114395]
    Other proteins in same PDB: d1w93a1, d1w93a3
    has additional insertions and/or extensions that are not grouped together

Details for d1w93a2

PDB Entry: 1w93 (more details), 2.5 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae
PDB Compounds: (A:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1w93a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w93a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrsl

SCOPe Domain Coordinates for d1w93a2 are not available.

Timeline for d1w93a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w93a1, d1w93a3