PDB entry 1w93

View 1w93 on RCSB PDB site
Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae
Class: ligase
Keywords: obesity, diabetes, fatty acid metabolism, structure-based drug design, allosteric inhibition, polyketide, ligase
Deposited on 2004-10-05, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.254
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w93a1, d1w93a2, d1w93a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w93A (A:)
    meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
    eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
    ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiva
    qsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmika
    seggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtnis
    lfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshddg
    kfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsaseid
    fefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvg
    nngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedfe
    dntittgwlddli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w93A (A:)
    meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
    eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
    ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiva
    qsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmika
    seggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtnis
    lfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshddg
    kfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsaseid
    fefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvg
    nngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgtveyliklletedfednti
    ttgwlddli