Lineage for d1w8xm_ (1w8x M:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649079Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 2649080Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 2649081Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 2649203Protein PRD1 capsid assembly [118379] (1 species)
  7. 2649204Species Bacteriophage PRD1 [TaxId:10658] [118380] (1 PDB entry)
  8. 2649217Domain d1w8xm_: 1w8x M: [114390]

Details for d1w8xm_

PDB Entry: 1w8x (more details), 4.2 Å

PDB Description: structural analysis of prd1
PDB Compounds: (M:) protein p30

SCOPe Domain Sequences for d1w8xm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8xm_ i.6.1.1 (M:) PRD1 capsid assembly {Bacteriophage PRD1 [TaxId: 10658]}
alinpqfpyagpvpipgpaptetmpllnyrvegriagiqqarqfmpflqgphravaeqty
haigtgiqmgqtfnqplintqeg

SCOPe Domain Coordinates for d1w8xm_:

Click to download the PDB-style file with coordinates for d1w8xm_.
(The format of our PDB-style files is described here.)

Timeline for d1w8xm_: