![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
![]() | Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
![]() | Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) |
![]() | Protein PRD1 capsid assembly [118379] (1 species) |
![]() | Species Bacteriophage PRD1 [TaxId:10658] [118380] (1 PDB entry) |
![]() | Domain d1w8xk_: 1w8x K: [114388] |
PDB Entry: 1w8x (more details), 4.2 Å
SCOPe Domain Sequences for d1w8xk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8xk_ i.6.1.1 (K:) PRD1 capsid assembly {Bacteriophage PRD1 [TaxId: 10658]} qqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgi vkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntak qgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlan vpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp ktvnqnarllmgyeyftsrtelvn
Timeline for d1w8xk_: