SCOP 1.75: Domain d1w8ma_: 1w8m A:

Lineage for d1w8ma_ (1w8m A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (4 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
   Uniprot P05092

8. Domain d1w8ma_: 1w8m A: [114370]
   complexed with e1p

Details for d1w8ma_

PDB Entry: 1w8m, 1.65 Å

PDB Description: enzymatic and structural characterisation of non peptide ligand cyclophilin complexes

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOP Domain Sequences for d1w8ma_:

Sequence; same for both SEQRES and ATOM records:

>d1w8ma_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1w8ma_:

• d1w8ma_ first appeared in SCOP 1.71
  
• d1w8ma_ appears in SCOP 1.73
  
• d1w8ma_ appears in SCOPe 2.01
  
• d1w8ma_ appears in the current release, SCOPe 2.08